Aiken jail report Send us your comments to publisher@thejailreport. For arrests made after May 17th, 2021, please use the New Search. 6 days ago · Aiken County. 420 Hampton Ave, NE. Aiken County is a part of the Augusta-Richmond County, GA-SC Metropolitan Statistical Area. This Pamela Anderson has also been arrested before. Aiken County Jail and Inmate Search. Dec 3, 2024 · Greg Rickabaugh is an award-winning crime reporter in the Augusta-Aiken area with experience writing for The Augusta Chronicle and serving as publisher of The Jail Report. Content is public domain and is compiled from public records. When officers arrived, they discovered the body of an unidentified female in one of the hotel rooms. 6. If you are listed in the report, one will be provided to you at no cost. The document is a newspaper containing local crime reports and articles. Disclaimer: Information posted on this website is provided for informational purposes only, and is subject to change and may be updated periodically. The murder warrant says she shot "him multiple times in the back and multiple (times) while he was lying on the floor. ". Aiken County. To Report a Non-Emergency: (803) 648-6811 (800) 922-9709 2 days ago · Aiken County is a county in the U. The Jail Report - Issue 1323 (Online Only) - Free download as PDF File (. com. Columbia County. Rickabaugh is a 1994 graduate of the University of South Carolina and has appeared on several crime documentaries on the Investigation Fire Reports can only be picked up by coming to Aiken Department of Public Safety’s Headquarters Building at 834 Beaufort Street, NE Monday-Friday 8 am-5pm. You can access the Aiken County Jail roster online or in person at the Aiken County Correctional Center. You can call them 24 hours a day for inmate details at 803-642-2040 . He was 40 years old on the day of the booking. The Aiken County Detention Center, located in South Carolina, is a correctional facility under the jurisdiction of the Aiken County Sheriff's Office, responsible for housing individuals awaiting trial or serving sentences for various offenses within the criminal justice system. On Friday, Oct. Jail Records in Aiken County (South Carolina) Find jail records in Aiken County, SC. There may be an automated method of looking them up by their name over the phone, or you may be directed to speak to someone at the jail. Jul 14, 2022 · RICHMOND • AIKEN • COLUMBIA • EDGEFIELD JULY 8-14, 2022 • YEAR 13, ISSUE 7. Feb 14, 2020 · The Jail Report - Feb. Its county seat and largest community is Aiken. All persons listed have only been charged unless otherwise stated. Crime News and Mugshots Updated Hourly! 4 days ago · Your daily source for crime alerts, breaking news, crime reports and wanted fugitives in Aiken, Edgefield and Barnwell counties. 1; 2; 3; 4; Located in the city of Aiken, Aiken County, South Carolina, the Aiken County Detention Center is a 450-bed facility. The Aiken County Sheriff's Office is in the people-serving business. Find Aiken County, SC arrest records easily. Dial 9-1-1 For Emergencies. When breaking down the AIKEN County jail population by gender, females are a minority compared to male prisoners and make 14% with 46 female and 274 male inmates. The Jail Report n r s o p S e t o d 6 4 h f A u g i h 2 4 h g 4 1 u 1 7 l s 7 h 1 g 1 f 7 4 h m 4 g 7 i , t m 1 u 0 8 t t u a 2 8 0 · Shared with Public CONTACT THE JAIL REPORT: 803-487-3224 Content in The Jail Report is deemed to be in the public domain, compiled from public records for public consumption. Sara Rhinehart. 1(1) - Traffic - DWI - Operate Motor Vehicle Under Influence of Apr 1, 2025 · Aiken County is a county in the U. Take a look at our local jail report featuring ‘Aiken County Pair Accused of Badly Injuring 6-Week-Old’ Details on page Showing 1-10 of 34 results. General Information: (803) 642-1761. 2 Largest Database of Aiken County Mugshots. Aiken County Detention Center 435 Wire Road, Aiken, SC 29801 Phone: (803) 642-2040. The Jail Report's Augusta-Aiken edition published on May 31, 2017. As a law enforcement professional, I pledge to serve all the citizens and visitors of Aiken County. AugustaCrime. com The Jail Report is a weekly publication created by Rickabaugh Publishing, LLC. Inmate Calls: Inmate Call System and Regulations: Inmates at Aiken County Correctional Center are permitted to make phone calls to friends and family members. As of the 2020 census, its population was 168,808. Page 19: The Augusta Murder of a $2. Please purchase the Jail Report Addon in order to view this issue by clicking: The Aiken County Detention Center is located at 435 Wire Road in Aiken. Use inmate search tools for details on current inmates, visitation policies, commissary programs, and sending money. 00 Mar 24, 2025 · How do I report an issue or concern about an inmate at Aiken County SC Detention Center? Family members and advocates can report concerns to jail administration, a prisoner rights organization, or a legal representative. Historical Search New Search New Aiken County Jail Inmate Search. thejailreport. All suspects are innocent until proven guilty. Oct 11, 2024 · By Staff Report Take a look at our local Jail Report featuring Aiken County Man, 74,Points Gun in Road Rage Case, check it out on page 8. For arrests made prior to May 17th, 2021, please use the Historical Search. PagPage 20: Armed with Knives, e 20: Armed with Knives, $2. Walmart Customers Report Harassment of Juvenile Girls Before Assault in North Augusta. For more information on our weekly newspaper, go to www. The Jail Report. 14, 2020 Issue - Free download as PDF File (. The facility has an average daily population of 407 inmates, who either are awaiting trial, or are serving sentences less than 90 days. 1 day ago. 00 Green Beret by a Repeat Offender Largest Database of Aiken County Mugshots. He also owns AugustaCrime. Do a search online using this person’s name, the town or city you think they were arrested in, and the crime you think they were arrested for. Constantly updated. The City of Augusta and the Richmond County Sheriff’s Office provide access to current inmate information as a service to the general public. 🔍📂 The county jail is the Aiken County Detention Center which is overseen by the Aiken County Sheriff's Office. CONTACT THE JAIL REPORT: 803-487-3224 Content in The Jail Report is deemed to be in the public domain, compiled from public records for public consumption. " The document summarizes local crime stories from the area, including: - A man was arrested for choking a woman who invited him into her bedroom after he tapped on her window late at night. For any inquiries or official purposes, you can use the following contact information for the Aiken County Jail: Mailing Address: Aiken County Jail 435 Wire Road Aiken, SC 29801 USA; Phone Number: (803) 642-2040. The Jail Report is a crime-fighting publication established in June 2009 in the Augusta-Aiken area. When there, he straddled and THEJAILREPORT. Hephzibah Woman Gets Scammed by Concrete Company. AIKEN County has 325 jails with an average daily population of 507 inmates with a total of 325 jail population. The Jail Report - Issue 901 - Free download as PDF File (. For those interested in Bail Bonds or seeking guidance on legal processes, the Sheriff's Department website offers a list of resources, including contacts for legal aid and bondsmen in Oct 19, 2024 · CHARLES BRAXTON was booked on 10/19/2024 in Aiken County, South Carolina. Sep 13, 2013 · Fighting crime through knowledge in Aiken, Richmond, Columbia, and Edgefield counties. Aiken County Detention Center 435 Wire Road Aiken, SC 29801 7. Opened in June 2002, ACDC is a state-of-the-art detention facility, with six housing units. 13, William Seamon III, of Cayce, South Carolina, was charged by Aiken Public Safety oficers with third-degree domestic violence, contempt of Page 1 of 4 Current-Inmate-Roster Printed on April 30, 2025 Inmate Booked Agency ANDERSON, KAMERON 02/03/25 Aitkin County Sheriff's Office 169A. To find out if someone you know has been recently arrested and booked into the Aiken County Detention Center, call the jail’s booking line at 803-642-2040. - An Aiken man was arrested for choking a female acquaintance who had invited him into her bedroom. Aiken County Sheriff's Office 420 Hampton Ave NE, Aiken, SC 29801 Phone: (803) 642-1761. Official Website: Aiken County Jail. Richmond County. S. This jail’s address is: Aiken County Detention Center 435 Wire Road Aiken, SC 29801 (803) 716-8518. 190,143 likes · 17,809 talking about this. May 6, 2019 · The Jail Report is a weekly publication created by Rickabaugh Publishing, LLC. Free Arrest Record Search in Aiken County. Weekly paper in SC and GA, with mugshots, crime news, wanted people, accidents and more. We are committed to work in partnership with all segments of our community, as well as, all areas of the criminal justice system, with renewed openness and responsiveness. Some jails have grievance procedures inmates can follow if they experience mistreatment. Use this website for informational purposes only. Page 4: Bud Light Controversy $2. Information posted on this website is provided for informational purposes only, and is subject to change and may be updated periodically. state of South Carolina. Detention Center Detainee Public Search. He was 22 years old on the day of the booking. Get jail records directly from official databases and websites. To Report a Non-Emergency: (803) 648-6811 (800) 922-9709 The jail roster is a public record and is available to anyone who wishes to view it. COM THE JAIL REPORT OCTOBER 20-26, 2023 5 AIKEN COUNTY A former Aiken County man who scanned $5,000 from a local restaurant owner has been arrested. 00 Doesn’t Matter to Local Shoplifter Access Aiken County Government services, including detention center detainee search and sheriff's office resources. Write or visit the jail and request information. Published by veteran journalist Greg Rickabaugh, The Jail Report is a family-run business which expanded in 2010 to the Greenville-Spartanburg region of […] Aiken County Detention Center Inmate Lookup, South Carolina. Residents can report non-emergencies using the provided contact numbers. Most recent Aiken County Bookings South Carolina. This jail serves as the processing center for offenders arrested for misdemeanors and felonies. Monday to investigate. Access tools for mugshots, booking records, and arrest records. However, in the event of an immediate threat or emergency, it's crucial to dial 911. ISAACS, RYAN | 2021-06-02 16:53:00 Aiken County, South Carolina Booking Booking Details name ISAACS, RYAN age 26 years oldsex Male arrested by ACSO booked 2021-06-02 Charges charge… 420 Hampton Ave, NE. Aug 17, 2022 Jason or his remains may be in Aiken county near beech Island but we really don't know. txt) or read online for free. The Aiken County Detention Center is located at 435 Wire Road, in Aiken. The Jail Report is a weekly publication created by Rickabaugh Publishing, LLC. Dec 2, 2024 · An Aiken veterinarian, Dr. Add your comments below each blog, but keep them clean. They are simply a record of the charge made by law enforcement. Every effort is made to keep the information provided through this Online Inmate Inquiry application accurate and up-to-date. Man Posed as Disney Worker to Expose ‘Flaws’, Page 12 CONTACT THE JAIL REPORT: 803-487-3224. Aiken County, South Carolina, provides resources to help locate inmates housed within its detention facilities. To fund a commissary account for an inmate in the jail, use the cashier kiosks located in the visitation lobby of the Center. The weekly newspaper includes mugshots and arrest information, wanted people, crime news, dumb crook stories and opinion columns. Reports must be paid for in cash. Apr 23, 2025 · Aiken County. Aiken SC 29801 Dial 9-1-1 For Emergencies. She remains behind bars today under a $5,000 bond. NOTE: GettingOut, the Aiken County Detention Center visitation service, will need to verify that you say who you claim to be prior to giving you permission to use their services online or at the jail lobby kiosk Sep 8, 2009 · Pamela Roberts Anderson, 45, of Aiken. 82,065 likes · 4,365 talking about this. To Report a Non-Emergency: (803) 648-6811 (800) 922-9709 3 days ago · Aiken County. Suspects pictured or named are innocent unless proven guilty in a court of law. New Report Shows Mother’s Threats to Jamestown Principal Ended in Standoff at Parent’s Home. Access state arrest records, public arrest records, and more through our comprehensive directory. 188,032 likes · 15,785 talking about this. Aug 18, 2024 · DYLAN TURNER was booked on 8/18/2024 in Aiken County, South Carolina. The Aiken County Detention Center maintains an online database that allows the public to search for inmates. Comments that are obscene, insulting or potentially libelous will be deleted. To access Aiken County arrest records for free: The Jail Report. m. pdf), Text File (. Jan 20, 2025 · Aiken County Coroner Darryl Ables confirmed that the Coroner’s Office was called to the scene at 5 a. Mugshots. Griff Griffin Jail Report pics of people you know. Law enforcement had received a report of shots fired around 4:41 a. Nov 3, 2021 · Greg Rickabaugh is an award-winning crime reporter in the Augusta-Aiken area with experience writing for The Augusta Chronicle, The Augusta Press and serving as publisher of The Jail Report. Rickabaugh is a 1994 graduate of the University of South Carolina and has appeared on several crime documentaries on the Investigation Discovery channel. For more information, please see the Aiken County Sheriff's Office website. The Aiken woman was arrested on Monday night by the sheriff's office and booked into the Aiken County Detention Center on a single count of violation of forgery, according to jail records. 29, 2021, because of unforeseen circumstances. - A woman tested positive for drugs while giving birth at a local hospital. Jennifer Ray, is charged with killing her husband, Greg Baughman, at their home on Sunday, with reports suggesting a history of domestic issues. Here is the issue we never got to print from Oct. Advertising information: 803-487-3224. New Report Shows Mother’s Threats to Jamestown Principal Ended in Standoff at Parent’s Crime news and reports for Augusta, GA and the CSRA Uncovered in Massive Jail Raid in Augusta following a months-long undercover operation at an Aiken massage It is always possible they were arrested there instead of Aiken County. 20. The Aiken County Detention Center reserves the right to deny any person the right to enter the jail it chooses and for any reason. The Jail Report 14K Followers, 42 Following, 710 Posts - Jail Report (@jailreport) on Instagram: "Weekly paper in SC and GA with mugshots, crime news, wanted people, accidents, & more. Find latests mugshots and bookings from Aiken and other local cities. If you are not listed in the report, the cost is $2 per report. Mugshots do not indicate guilt. uodcgqgvmiplshckdcykfwqgskpcylsnnnaclrerqgegvsflvfmhuhfwwstprhdefiqfgqnuujkngkgksnuvy